Class a: All alpha proteins [46456] (179 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (3 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (4 proteins) |
Protein Viral cyclin [47961] (3 species) |
Species Kaposi's sarcoma-associated virus [47964] (1 PDB entry) |
Domain d1g3ng1: 1g3n G:16-147 [18368] Other proteins in same PDB: d1g3na_, d1g3nb_, d1g3ne_, d1g3nf_ |
PDB Entry: 1g3n (more details), 2.9 Å
SCOP Domain Sequences for d1g3ng1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g3ng1 a.74.1.1 (G:16-147) Viral cyclin {Kaposi's sarcoma-associated virus} lcedrifynileieprfltsdsvfgtfqqsltshmrkllgtwmfsvcqeynlepnvvala lnlldrlllikqvskehfqktgsacllvasklrsltpistsslcyaaadsfsrqelidqe kelleklawrte
Timeline for d1g3ng1: