Lineage for d1g3nc1 (1g3n C:16-147)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4853Fold a.74: Cyclin-like [47953] (1 superfamily)
  4. 4854Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
  5. 4855Family a.74.1.1: Cyclin [47955] (3 proteins)
  6. 4885Protein Viral cyclin [47961] (3 species)
  7. 4889Species Kaposi sarcoma-associated virus [47964] (1 PDB entry)
  8. 4890Domain d1g3nc1: 1g3n C:16-147 [18366]
    Other proteins in same PDB: d1g3na_, d1g3nb_, d1g3ne_, d1g3nf_

Details for d1g3nc1

PDB Entry: 1g3n (more details), 2.9 Å

PDB Description: structure of a p18(ink4c)-cdk6-k-cyclin ternary complex

SCOP Domain Sequences for d1g3nc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3nc1 a.74.1.1 (C:16-147) Viral cyclin {Kaposi sarcoma-associated virus}
lcedrifynileieprfltsdsvfgtfqqsltshmrkllgtwmfsvcqeynlepnvvala
lnlldrlllikqvskehfqktgsacllvasklrsltpistsslcyaaadsfsrqelidqe
kelleklawrte

SCOP Domain Coordinates for d1g3nc1:

Click to download the PDB-style file with coordinates for d1g3nc1.
(The format of our PDB-style files is described here.)

Timeline for d1g3nc1: