Lineage for d1f5qd1 (1f5q D:5-146)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283121Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 283122Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 283123Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 283209Protein Viral cyclin [47961] (3 species)
  7. 283220Species Murine herpes virus gamma 68 [47963] (1 PDB entry)
  8. 283223Domain d1f5qd1: 1f5q D:5-146 [18364]
    Other proteins in same PDB: d1f5qa_, d1f5qc_

Details for d1f5qd1

PDB Entry: 1f5q (more details), 2.5 Å

PDB Description: crystal structure of murine gamma herpesvirus cyclin complexed to human cyclin dependent kinase 2

SCOP Domain Sequences for d1f5qd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5qd1 a.74.1.1 (D:5-146) Viral cyclin {Murine herpes virus gamma 68}
efqgfldssllneedcrqmiyrserehdarmvgvnvdqhftsqyrkvlttwmfcvckdlr
qdnnvfplavalldelflstridrenyqstaavalhiagkvraympikatqlaylcggat
tadklltlevksldtlswvadr

SCOP Domain Coordinates for d1f5qd1:

Click to download the PDB-style file with coordinates for d1f5qd1.
(The format of our PDB-style files is described here.)

Timeline for d1f5qd1: