Class a: All alpha proteins [46456] (285 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Viral cyclin [47961] (3 species) |
Species Murine herpesvirus 68 [TaxId:33708] [47963] (1 PDB entry) |
Domain d1f5qb2: 1f5q B:147-252 [18363] Other proteins in same PDB: d1f5qa_, d1f5qc_ complexed with cl |
PDB Entry: 1f5q (more details), 2.5 Å
SCOPe Domain Sequences for d1f5qb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f5qb2 a.74.1.1 (B:147-252) Viral cyclin {Murine herpesvirus 68 [TaxId: 33708]} clstdlicyilhimhapredylniynlcrpkifcalcdgrsamkrpvlitlacmhltmnq kydyyenridgvckslyitkeelhqccdlvdiaivsfdenyfkina
Timeline for d1f5qb2:
View in 3D Domains from other chains: (mouse over for more information) d1f5qa_, d1f5qc_, d1f5qd1, d1f5qd2 |