SCOPe 2.08: Domain d1f5qb1: 1f5q B:6-146

Lineage for d1f5qb1 (1f5q B:6-146)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Viral cyclin [47961] (3 species)

7. Species Murine herpesvirus 68 [TaxId:33708] [47963] (1 PDB entry)

8. Domain d1f5qb1: 1f5q B:6-146 [18362]
   Other proteins in same PDB: d1f5qa_, d1f5qc_
   complexed with cl

Details for d1f5qb1

PDB Entry: 1f5q, 2.5 Å

PDB Description: crystal structure of murine gamma herpesvirus cyclin complexed to human cyclin dependent kinase 2

PDB Compounds: (B:) gamma herpesvirus cyclin

SCOPe Domain Sequences for d1f5qb1:

Sequence; same for both SEQRES and ATOM records:

>d1f5qb1 a.74.1.1 (B:6-146) Viral cyclin {Murine herpesvirus 68 [TaxId: 33708]}
fqgfldssllneedcrqmiyrserehdarmvgvnvdqhftsqyrkvlttwmfcvckdlrq
dnnvfplavalldelflstridrenyqstaavalhiagkvraympikatqlaylcggatt
adklltlevksldtlswvadr

Timeline for d1f5qb1:

• d1f5qb1 first appeared (with stable ids) in SCOP 1.55
  
• d1f5qb1 appears in SCOPe 2.07