SCOPe 2.08: Domain d3p9ha1: 3p9h A:2-145

Lineage for d3p9ha1 (3p9h A:2-145)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.2: UEV domain [75383] (3 proteins)

6. Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75385] (14 PDB entries)

8. Domain d3p9ha1: 3p9h A:2-145 [183604]
   Other proteins in same PDB: d3p9ha2
   automated match to d1kppa_

Details for d3p9ha1

PDB Entry: 3p9h, 1.8 Å

PDB Description: Crystal structure of the TSG101 UEV domain in complex with FA258 peptide

PDB Compounds: (A:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d3p9ha1:

Sequence; same for both SEQRES and ATOM records:

>d3p9ha1 d.20.1.2 (A:2-145) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyggsrelmnltgtipvpyrg
ntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqsdll
gliqvmivvfgdeppvfsrp

Timeline for d3p9ha1:

• d3p9ha1 first appeared in SCOPe 2.01, called d3p9ha_
  
• d3p9ha1 appears in SCOPe 2.07