Lineage for d1bu2a1 (1bu2 A:22-148)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4853Fold a.74: Cyclin-like [47953] (1 superfamily)
  4. 4854Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
  5. 4855Family a.74.1.1: Cyclin [47955] (3 proteins)
  6. 4885Protein Viral cyclin [47961] (3 species)
  7. 4886Species Herpes virus saimiri [47962] (1 PDB entry)
  8. 4887Domain d1bu2a1: 1bu2 A:22-148 [18360]

Details for d1bu2a1

PDB Entry: 1bu2 (more details), 3 Å

PDB Description: x-ray structure of a viral cyclin from herpesvirus saimiri

SCOP Domain Sequences for d1bu2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bu2a1 a.74.1.1 (A:22-148) Viral cyclin {Herpes virus saimiri}
rvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfeldksvfplsvsild
rylckkqgtkktlqkigaacvligskirtvkpmtvskltylscdcftnlelinqekdile
alkwdte

SCOP Domain Coordinates for d1bu2a1:

Click to download the PDB-style file with coordinates for d1bu2a1.
(The format of our PDB-style files is described here.)

Timeline for d1bu2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bu2a2