Lineage for d3p7ya_ (3p7y A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2827846Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2828250Protein Pentaerythritol tetranirate reductase [63900] (1 species)
  7. 2828251Species Enterobacter cloacae [TaxId:550] [63901] (33 PDB entries)
    Uniprot P71278
  8. 2828265Domain d3p7ya_: 3p7y A: [183583]
    automated match to d1gvra_
    complexed with fmn, p7y

    has additional insertions and/or extensions that are not grouped together

Details for d3p7ya_

PDB Entry: 3p7y (more details), 1.2 Å

PDB Description: pentaerythritol tetranitrate reductase co-crystal structure with bound (e)-1-(2'-hydroxyphenyl)-2-nitroethene
PDB Compounds: (A:) Pentaerythritol tetranitrate reductase

SCOPe Domain Sequences for d3p7ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p7ya_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]}
aeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqi
saqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvs
asalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelh
sahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfq
nvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigag
aytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdy
psl

SCOPe Domain Coordinates for d3p7ya_:

Click to download the PDB-style file with coordinates for d3p7ya_.
(The format of our PDB-style files is described here.)

Timeline for d3p7ya_: