SCOPe 2.03: Domain d3p71c_: 3p71 C:

Lineage for d3p71c_ (3p71 C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha [143933] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143934] (12 PDB entries)
   Uniprot P67775 2-294

8. Domain d3p71c_: 3p71 C: [183568]
   Other proteins in same PDB: d3p71t_
   automated match to d2nylc1
   complexed with an6, mn, peg

Details for d3p71c_

PDB Entry: 3p71, 2.7 Å

PDB Description: Crystal structure of the complex of LCMT-1 and PP2A

PDB Compounds: (C:) Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform

SCOPe Domain Sequences for d3p71c_:

Sequence; same for both SEQRES and ATOM records:

>d3p71c_ d.159.1.3 (C:) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]}
dekvftkeldqwieqlneckqlsesqvkslcekakeiltkesnvqevrcpvtvcgdvhgq
fhdlmelfriggkspdtnylfmgdyvdrgyysvetvtllvalkvryreritilrgnhesr
qitqvygfydeclrkygnanvwkyftdlfdylpltalvdgqifclhgglspsidtldhir
aldrlqevphegpmcdllwsdpddrggwgisprgagytfgqdisetfnhangltlvsrah
qlvmegynwchdrnvvtifsapnycyrcgnqaaimelddtlkysflqfdpaphvtrrtpd
yfl

Timeline for d3p71c_:

• d3p71c_ first appeared in SCOPe 2.01
  
• d3p71c_ appears in SCOPe 2.02
  
• d3p71c_ appears in SCOPe 2.04
  
• d3p71c_ appears in the current release, SCOPe 2.08