Lineage for d1vin_2 (1vin 309-432)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4853Fold a.74: Cyclin-like [47953] (1 superfamily)
  4. 4854Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
  5. 4855Family a.74.1.1: Cyclin [47955] (3 proteins)
  6. 4856Protein Cyclin A [47956] (2 species)
  7. 4857Species Cow (Bos taurus) [TaxId:9913] [47958] (1 PDB entry)
  8. 4859Domain d1vin_2: 1vin 309-432 [18355]

Details for d1vin_2

PDB Entry: 1vin (more details), 2 Å

PDB Description: bovine cyclin a3

SCOP Domain Sequences for d1vin_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vin_2 a.74.1.1 (309-432) Cyclin A {Cow (Bos taurus)}
ptinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvt
gqswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhgvsllnppe
tlnl

SCOP Domain Coordinates for d1vin_2:

Click to download the PDB-style file with coordinates for d1vin_2.
(The format of our PDB-style files is described here.)

Timeline for d1vin_2:

Domains from same chain:
(mouse over for more information)
d1vin_1