SCOP 1.63: Domain d1vin_1: 1vin 181-308

Lineage for d1vin_1 (1vin 181-308)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (4 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47958] (1 PDB entry)

8. Domain d1vin_1: 1vin 181-308 [18354]

Details for d1vin_1

PDB Entry: 1vin, 2 Å

PDB Description: bovine cyclin a3

SCOP Domain Sequences for d1vin_1:

Sequence; same for both SEQRES and ATOM records:

>d1vin_1 a.74.1.1 (181-308) Cyclin A {Cow (Bos taurus)}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vlafdlaa

Timeline for d1vin_1:

• d1vin_1 first appeared (with stable ids) in SCOP 1.55
  
• d1vin_1 appears in SCOP 1.61
  
• d1vin_1 appears in SCOP 1.65
  
• d1vin_1 appears in the current release, SCOPe 2.08, called d1vina1