Lineage for d3p5ia_ (3p5i A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (17 species)
    not a true protein
  7. 2559734Species Human (Homo sapiens) [TaxId:9606] [186882] (84 PDB entries)
  8. 2559779Domain d3p5ia_: 3p5i A: [183533]
    automated match to d1k9jb_
    complexed with ca

Details for d3p5ia_

PDB Entry: 3p5i (more details), 1.8 Å

PDB Description: Structure of the carbohydrate-recognition domain of human Langerin with 6-SO4-Gal-GlcNAc
PDB Compounds: (A:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d3p5ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p5ia_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk
agmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflf
ickrpyvp

SCOPe Domain Coordinates for d3p5ia_:

Click to download the PDB-style file with coordinates for d3p5ia_.
(The format of our PDB-style files is described here.)

Timeline for d3p5ia_: