Lineage for d3p5hb_ (3p5h B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940569Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1940570Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1941287Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1941288Protein automated matches [190159] (13 species)
    not a true protein
  7. 1941334Species Human (Homo sapiens) [TaxId:9606] [186882] (65 PDB entries)
  8. 1941362Domain d3p5hb_: 3p5h B: [183530]
    automated match to d1k9jb_
    complexed with bgc, ca

Details for d3p5hb_

PDB Entry: 3p5h (more details), 1.61 Å

PDB Description: structure of the carbohydrate-recognition domain of human langerin with laminaritriose
PDB Compounds: (B:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d3p5hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p5hb_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywiglt
kagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktfl
fickrpyvp

SCOPe Domain Coordinates for d3p5hb_:

Click to download the PDB-style file with coordinates for d3p5hb_.
(The format of our PDB-style files is described here.)

Timeline for d3p5hb_: