Lineage for d3p5ha_ (3p5h A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1048063Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1048064Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1048685Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1048686Protein automated matches [190159] (5 species)
    not a true protein
  7. 1048699Species Human (Homo sapiens) [TaxId:9606] [186882] (14 PDB entries)
  8. 1048706Domain d3p5ha_: 3p5h A: [183529]
    automated match to d1k9jb_
    complexed with bgc, ca

Details for d3p5ha_

PDB Entry: 3p5h (more details), 1.61 Å

PDB Description: structure of the carbohydrate-recognition domain of human langerin with laminaritriose
PDB Compounds: (A:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d3p5ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p5ha_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk
agmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflf
ickrpyvp

SCOPe Domain Coordinates for d3p5ha_:

Click to download the PDB-style file with coordinates for d3p5ha_.
(The format of our PDB-style files is described here.)

Timeline for d3p5ha_: