Lineage for d3p5fa_ (3p5f A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1443240Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1443241Protein automated matches [190159] (8 species)
    not a true protein
  7. 1443271Species Human (Homo sapiens) [TaxId:9606] [186882] (56 PDB entries)
  8. 1443312Domain d3p5fa_: 3p5f A: [183521]
    automated match to d1k9jb_
    complexed with ca, man

Details for d3p5fa_

PDB Entry: 3p5f (more details), 1.75 Å

PDB Description: structure of the carbohydrate-recognition domain of human langerin with man2 (man alpha1-2 man)
PDB Compounds: (A:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d3p5fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p5fa_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk
agmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflf
ickrpyvp

SCOPe Domain Coordinates for d3p5fa_:

Click to download the PDB-style file with coordinates for d3p5fa_.
(The format of our PDB-style files is described here.)

Timeline for d3p5fa_: