Lineage for d1fvvb2 (1fvv B:310-432)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1739685Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1739686Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1739687Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 1739700Protein Cyclin A [47956] (2 species)
  7. 1739736Species Human (Homo sapiens) [TaxId:9606] [47957] (75 PDB entries)
    Uniprot P20248 175-432
  8. 1740012Domain d1fvvb2: 1fvv B:310-432 [18351]
    Other proteins in same PDB: d1fvva_, d1fvvc_
    complexed with 107

Details for d1fvvb2

PDB Entry: 1fvv (more details), 2.8 Å

PDB Description: the structure of cdk2/cyclin a in complex with an oxindole inhibitor
PDB Compounds: (B:) cyclin a

SCOPe Domain Sequences for d1fvvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvvb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOPe Domain Coordinates for d1fvvb2:

Click to download the PDB-style file with coordinates for d1fvvb2.
(The format of our PDB-style files is described here.)

Timeline for d1fvvb2: