Class a: All alpha proteins [46456] (258 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (3 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (4 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (28 PDB entries) |
Domain d1fvvb2: 1fvv B:310-432 [18351] Other proteins in same PDB: d1fvva_, d1fvvc_ |
PDB Entry: 1fvv (more details), 2.8 Å
SCOP Domain Sequences for d1fvvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fvvb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet lnl
Timeline for d1fvvb2:
View in 3D Domains from other chains: (mouse over for more information) d1fvva_, d1fvvc_, d1fvvd1, d1fvvd2 |