Lineage for d3p4me_ (3p4m E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1290588Protein beta2-microglobulin [88600] (5 species)
  7. 1291129Species Mouse (Mus musculus) [TaxId:10090] [88603] (155 PDB entries)
    Uniprot P01887
  8. 1291244Domain d3p4me_: 3p4m E: [183500]
    automated match to d1biib_
    complexed with ace

Details for d3p4me_

PDB Entry: 3p4m (more details), 2.5 Å

PDB Description: Crystal Structure of H2-Kb in complex with the NP205-LCMV epitope YTVKYPNL, an 8-mer peptide from the LCMV
PDB Compounds: (E:) Beta-2-microglobulin

SCOPe Domain Sequences for d3p4me_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p4me_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d3p4me_:

Click to download the PDB-style file with coordinates for d3p4me_.
(The format of our PDB-style files is described here.)

Timeline for d3p4me_: