Class b: All beta proteins [48724] (180 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (20 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189530] (3 PDB entries) |
Domain d3p48a_: 3p48 A: [183494] automated match to d1q5hb_ complexed with dup, mg |
PDB Entry: 3p48 (more details), 1.67 Å
SCOPe Domain Sequences for d3p48a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p48a_ b.85.4.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygria prsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqi vvvdsle
Timeline for d3p48a_: