SCOPe 2.01: Domain d3p3pa_: 3p3p A:

Lineage for d3p3pa_ (3p3p A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (2 proteins)

6. Protein automated matches [190145] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186870] (13 PDB entries)

8. Domain d3p3pa_: 3p3p A: [183490]
   automated match to d1iz3a_
   complexed with akg, fe2, gol, so4

Details for d3p3pa_

PDB Entry: 3p3p, 2.6 Å

PDB Description: Factor inhibiting HIF-1 Alpha in complex with Notch 1 fragment mouse notch (1997-2016) peptide

PDB Compounds: (A:) Hypoxia-inducible factor 1-alpha inhibitor

SCOPe Domain Sequences for d3p3pa_:

Sequence; same for both SEQRES and ATOM records:

>d3p3pa_ b.82.2.6 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtn
lvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhef
veklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnlll
igmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpd
yerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkriey
plkahqkvaimrniekmlgealgnpqevgpllntmikgryn

Timeline for d3p3pa_:

• d3p3pa_ is new in SCOPe 2.01-stable
  
• d3p3pa_ appears in SCOPe 2.02
  
• d3p3pa_ appears in the current release, SCOPe 2.08