Lineage for d1jstd2 (1jst D:310-432)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99168Fold a.74: Cyclin-like [47953] (1 superfamily)
  4. 99169Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
  5. 99170Family a.74.1.1: Cyclin [47955] (3 proteins)
  6. 99171Protein Cyclin A [47956] (2 species)
  7. 99175Species Human (Homo sapiens) [TaxId:9606] [47957] (6 PDB entries)
  8. 99189Domain d1jstd2: 1jst D:310-432 [18349]
    Other proteins in same PDB: d1jsta_, d1jstc_

Details for d1jstd2

PDB Entry: 1jst (more details), 2.6 Å

PDB Description: phosphorylated cyclin-dependent kinase-2 bound to cyclin a

SCOP Domain Sequences for d1jstd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jstd2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens)}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOP Domain Coordinates for d1jstd2:

Click to download the PDB-style file with coordinates for d1jstd2.
(The format of our PDB-style files is described here.)

Timeline for d1jstd2: