Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein automated matches [190149] (14 species) not a true protein |
Species Francisella tularensis [TaxId:177416] [189492] (1 PDB entry) |
Domain d3p2la_: 3p2l A: [183472] automated match to d1tyfa_ complexed with edo, gol, mg, peg, po4 |
PDB Entry: 3p2l (more details), 2.29 Å
SCOPe Domain Sequences for d3p2la_:
Sequence, based on SEQRES records: (download)
>d3p2la_ c.14.1.1 (A:) automated matches {Francisella tularensis [TaxId: 177416]} nlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiy fyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqim ihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeak ayglidhviesrea
>d3p2la_ c.14.1.1 (A:) automated matches {Francisella tularensis [TaxId: 177416]} nlvptviekrafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyins pggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqpl ggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakaygli dhviesrea
Timeline for d3p2la_: