Lineage for d3p1ra1 (3p1r A:1-231)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726458Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2726459Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2726519Protein automated matches [190238] (11 species)
    not a true protein
  7. 2726535Species Human (Homo sapiens) [TaxId:9606] [187008] (56 PDB entries)
  8. 2726561Domain d3p1ra1: 3p1r A:1-231 [183466]
    Other proteins in same PDB: d3p1ra2
    automated match to d1qjaa_
    complexed with ca, cl, mg

Details for d3p1ra1

PDB Entry: 3p1r (more details), 1.7 Å

PDB Description: crystal structure of human 14-3-3 sigma c38v/n166h in complex with task-3 peptide
PDB Compounds: (A:) 14-3-3 protein sigma

SCOPe Domain Sequences for d3p1ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p1ra1 a.118.7.1 (A:1-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsveernllsvayknvvggqraawr
vlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy
lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkemppthpirlglalnfsvfh
yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

SCOPe Domain Coordinates for d3p1ra1:

Click to download the PDB-style file with coordinates for d3p1ra1.
(The format of our PDB-style files is described here.)

Timeline for d3p1ra1: