Lineage for d3p1oa1 (3p1o A:1-231)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2010544Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2010545Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2010595Protein automated matches [190238] (9 species)
    not a true protein
  7. 2010604Species Human (Homo sapiens) [TaxId:9606] [187008] (42 PDB entries)
  8. 2010627Domain d3p1oa1: 3p1o A:1-231 [183463]
    Other proteins in same PDB: d3p1oa2
    automated match to d1qjaa_
    complexed with ca, cl, fsc, mg

Details for d3p1oa1

PDB Entry: 3p1o (more details), 1.9 Å

PDB Description: crystal structure of human 14-3-3 sigma in complex with task-3 peptide and stabilisator fusicoccin a
PDB Compounds: (A:) 14-3-3 protein sigma

SCOPe Domain Sequences for d3p1oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p1oa1 a.118.7.1 (A:1-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy
lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfh
yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

SCOPe Domain Coordinates for d3p1oa1:

Click to download the PDB-style file with coordinates for d3p1oa1.
(The format of our PDB-style files is described here.)

Timeline for d3p1oa1: