SCOPe 2.08: Domain d3p1mc1: 3p1m C:65-184

Lineage for d3p1mc1 (3p1m C:65-184)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein automated matches [190231] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189528] (5 PDB entries)

8. Domain d3p1mc1: 3p1m C:65-184 [183456]
   Other proteins in same PDB: d3p1ma2, d3p1mb2, d3p1mc2, d3p1md2, d3p1me2, d3p1mf2, d3p1mg2, d3p1mh2
   automated match to d1e6eb_
   complexed with fes, flc, gol, k

Details for d3p1mc1

PDB Entry: 3p1m, 2.54 Å

PDB Description: Crystal structure of human ferredoxin-1 (FDX1) in complex with iron-sulfur cluster

PDB Compounds: (C:) Adrenodoxin, mitochondrial

SCOPe Domain Sequences for d3p1mc1:

Sequence; same for both SEQRES and ATOM records:

>d3p1mc1 d.15.4.1 (C:65-184) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifedhiy
ekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsidvgkts

Timeline for d3p1mc1:

• d3p1mc1 first appeared in SCOPe 2.01, called d3p1mc_
  
• d3p1mc1 appears in SCOPe 2.07