Class a: All alpha proteins [46456] (285 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (74 PDB entries) Uniprot P20248 175-432 |
Domain d1find1: 1fin D:173-309 [18344] Other proteins in same PDB: d1fina_, d1finc_ complexed with atp |
PDB Entry: 1fin (more details), 2.3 Å
SCOPe Domain Sequences for d1find1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1find1 a.74.1.1 (D:173-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} nevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetl hlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvl rmehlvlkvltfdlaap
Timeline for d1find1:
View in 3D Domains from other chains: (mouse over for more information) d1fina_, d1finb1, d1finb2, d1finc_ |