Lineage for d3oxwc_ (3oxw C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2799131Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2799147Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2799148Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [187932] (17 PDB entries)
  8. 2799175Domain d3oxwc_: 3oxw C: [183393]
    automated match to d1kzka_
    complexed with 017, act, edo, gol, po4

Details for d3oxwc_

PDB Entry: 3oxw (more details), 1.95 Å

PDB Description: crystal structure of hiv-1 i50v, a71v protease in complex with the protease inhibitor darunavir
PDB Compounds: (C:) hiv-1 protease

SCOPe Domain Sequences for d3oxwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oxwc_ b.50.1.1 (C:) Human immunodeficiency virus type 1 protease {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggvggfikvrqyd
qipveicghkvigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d3oxwc_:

Click to download the PDB-style file with coordinates for d3oxwc_.
(The format of our PDB-style files is described here.)

Timeline for d3oxwc_: