SCOP 1.75: Domain d1jsub2: 1jsu B:310-432

Lineage for d1jsub2 (1jsu B:310-432)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (8 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (35 PDB entries)
   Uniprot P20248 175-432

8. Domain d1jsub2: 1jsu B:310-432 [18337]
   Other proteins in same PDB: d1jsua_, d1jsuc_
   complexed with so4; mutant

Details for d1jsub2

PDB Entry: 1jsu, 2.3 Å

PDB Description: p27(kip1)/cyclin a/cdk2 complex

PDB Compounds: (B:) cyclin a

SCOP Domain Sequences for d1jsub2:

Sequence; same for both SEQRES and ATOM records:

>d1jsub2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Timeline for d1jsub2:

• d1jsub2 first appeared (with stable ids) in SCOP 1.55
  
• d1jsub2 appears in SCOP 1.73
  
• d1jsub2 appears in SCOPe 2.01
  
• d1jsub2 appears in the current release, SCOPe 2.08