Class a: All alpha proteins [46456] (258 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (3 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (4 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (28 PDB entries) |
Domain d1jsub1: 1jsu B:175-309 [18336] Other proteins in same PDB: d1jsua_, d1jsuc_ |
PDB Entry: 1jsu (more details), 2.3 Å
SCOP Domain Sequences for d1jsub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jsub1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm ehlvlkvltfdlaap
Timeline for d1jsub1: