Lineage for d1d1da2 (1d1d A:11-150)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) 
Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (4 proteins) Protein RSV capsid protein [47951] (1 species) Species Rous sarcoma virus [TaxId:11886] [47952] (2 PDB entries) 
Domain d1d1da2: 1d1d A:11-150 [18335]
Other proteins in same PDB: d1d1da1
Details for d1d1da2
PDB Entry: 1d1d (more details)
PDB Description: nmr solution structure of the capsid protein from rous sarcoma virus
SCOP Domain Sequences for d1d1da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d1da2 a.73.1.1 (A:11-150) RSV capsid protein {Rous sarcoma virus}
wtplepklitrladtvrtkglrspitmaevealmsspllphdvtnlmrvilgpapyalwm
dawgvqlqtviaaatrdprhpangqgrgertnldrlkgladgmvgnpqgqaallrpgelv
aitasalqafrevarlaepa
SCOP Domain Coordinates for d1d1da2:
Click to download the PDB-style file with coordinates for d1d1da2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d1da2:
- d1d1da2 appears in SCOP 1.57
- d1d1da2 appears in the current release, SCOPe 2.08
View in 3D
