Lineage for d3ougg_ (3oug G:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550393Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 1550447Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 1550627Family b.52.2.0: automated matches [191648] (1 protein)
    not a true family
  6. 1550628Protein automated matches [191195] (6 species)
    not a true protein
  7. 1550638Species Francisella tularensis [TaxId:177416] [189506] (1 PDB entry)
  8. 1550644Domain d3ougg_: 3oug G: [183300]
    automated match to d1pt1a_
    complexed with cl, gol

Details for d3ougg_

PDB Entry: 3oug (more details), 1.55 Å

PDB Description: Crystal structure of cleaved L-aspartate-alpha-decarboxylase from Francisella tularensis
PDB Compounds: (G:) Aspartate 1-decarboxylase

SCOPe Domain Sequences for d3ougg_:

Sequence, based on SEQRES records: (download)

>d3ougg_ b.52.2.0 (G:) automated matches {Francisella tularensis [TaxId: 177416]}
mlisvlkskisyatvtgkdlfyvgsitidseimkqaniienekvqvvnlnngerletyvi
kgepnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlk

Sequence, based on observed residues (ATOM records): (download)

>d3ougg_ b.52.2.0 (G:) automated matches {Francisella tularensis [TaxId: 177416]}
mlisvlkskisyatvtgkdlfyvsitidseimkqaniienekvqvvnlnngerletyvik
gepnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlk

SCOPe Domain Coordinates for d3ougg_:

Click to download the PDB-style file with coordinates for d3ougg_.
(The format of our PDB-style files is described here.)

Timeline for d3ougg_: