Lineage for d3otfa_ (3otf A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2816658Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2816664Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 2816817Protein automated matches [190352] (10 species)
    not a true protein
  7. 2816845Species Human (Homo sapiens) [TaxId:9606] [189505] (8 PDB entries)
  8. 2816851Domain d3otfa_: 3otf A: [183280]
    automated match to d1q5oa_
    complexed with cmp

Details for d3otfa_

PDB Entry: 3otf (more details), 2.4 Å

PDB Description: structural basis for the camp-dependent gating in human hcn4 channel
PDB Compounds: (A:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4

SCOPe Domain Sequences for d3otfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3otfa_ b.82.3.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgelseplree
iinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetvaldrldrigkk

SCOPe Domain Coordinates for d3otfa_:

Click to download the PDB-style file with coordinates for d3otfa_.
(The format of our PDB-style files is described here.)

Timeline for d3otfa_: