Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) |
Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins) |
Protein automated matches [191245] (3 species) not a true protein |
Species Xenorhabdus nematophila [TaxId:628] [189729] (1 PDB entry) |
Domain d3osxa1: 3osx A:191-376 [183274] Other proteins in same PDB: d3osxa2, d3osxa3 automated match to d1kida_ |
PDB Entry: 3osx (more details), 1.55 Å
SCOPe Domain Sequences for d3osxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3osxa1 c.8.5.1 (A:191-376) automated matches {Xenorhabdus nematophila [TaxId: 628]} egmqfdrgylspyfinkpesgsvelenpyillvdkkisnirellpvlegvakaskplvii aedvegealatlvvnnmrgivkvasvkapgfgdrrkamlqdiatltngtviseeiglele katledlgqakrvvinkdtttiidgvgeegaiaarvtqirqqieestsdydreklqerva klaggv
Timeline for d3osxa1: