SCOPe 2.08: Domain d3osxa1: 3osx A:191-376

Lineage for d3osxa1 (3osx A:191-376)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families)

5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)

6. Protein automated matches [191245] (3 species)
   not a true protein

7. Species Xenorhabdus nematophila [TaxId:628] [189729] (1 PDB entry)

8. Domain d3osxa1: 3osx A:191-376 [183274]
   Other proteins in same PDB: d3osxa2, d3osxa3
   automated match to d1kida_

Details for d3osxa1

PDB Entry: 3osx, 1.55 Å

PDB Description: Crystal Structure of Apical Domain of Insecticidal GroEL from Xenorhapdus nematophila

PDB Compounds: (A:) 60 kda chaperonin

SCOPe Domain Sequences for d3osxa1:

Sequence; same for both SEQRES and ATOM records:

>d3osxa1 c.8.5.1 (A:191-376) automated matches {Xenorhabdus nematophila [TaxId: 628]}
egmqfdrgylspyfinkpesgsvelenpyillvdkkisnirellpvlegvakaskplvii
aedvegealatlvvnnmrgivkvasvkapgfgdrrkamlqdiatltngtviseeiglele
katledlgqakrvvinkdtttiidgvgeegaiaarvtqirqqieestsdydreklqerva
klaggv

Timeline for d3osxa1:

• d3osxa1 first appeared in SCOPe 2.01, called d3osxa_
  
• d3osxa1 appears in SCOPe 2.07