Lineage for d3orvc_ (3orv C:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034451Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 3034452Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 3034453Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 3034454Protein Methylamine dehydrogenase [57563] (2 species)
  7. 3034455Species Paracoccus denitrificans [TaxId:266] [57564] (24 PDB entries)
  8. 3034466Domain d3orvc_: 3orv C: [183251]
    Other proteins in same PDB: d3orvd_, d3orvf_
    automated match to d1mg2b_
    complexed with ca, edo, hec, p6g, peg, pg4, pge

Details for d3orvc_

PDB Entry: 3orv (more details), 1.91 Å

PDB Description: Crystal Structure of the Y294H-MauG/pre-Methylamine Dehydrogenase Complex
PDB Compounds: (C:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3orvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3orvc_ g.21.1.1 (C:) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgka

SCOPe Domain Coordinates for d3orvc_:

Click to download the PDB-style file with coordinates for d3orvc_.
(The format of our PDB-style files is described here.)

Timeline for d3orvc_: