SCOPe 2.07: Domain d3or7c_: 3or7 C:

Lineage for d3or7c_ (3or7 C:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families)
   Pfam PF00520

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein automated matches [190184] (3 species)
   not a true protein

7. Species Streptomyces lividans [TaxId:1916] [186922] (11 PDB entries)

8. Domain d3or7c_: 3or7 C: [183247]
   Other proteins in same PDB: d3or7a1, d3or7a2, d3or7a3, d3or7b1, d3or7b2
   automated match to d1k4cc_
   complexed with k

Details for d3or7c_

PDB Entry: 3or7, 2.3 Å

PDB Description: on the structural basis of modal gating behavior in k+channels - e71i

PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d3or7c_:

Sequence; same for both SEQRES and ATOM records:

>d3or7c_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvitattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d3or7c_:

• d3or7c_ first appeared in SCOPe 2.01
  
• d3or7c_ appears in SCOPe 2.06
  
• d3or7c_ appears in the current release, SCOPe 2.08