SCOP 1.63: Domain d1afva_: 1afv A:

Lineage for d1afva_ (1afv A:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (4 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (8 PDB entries)

8. Domain d1afva_: 1afv A: [18324]
   Other proteins in same PDB: d1afvh1, d1afvh2, d1afvk1, d1afvk2, d1afvl1, d1afvl2, d1afvm1, d1afvm2

Details for d1afva_

PDB Entry: 1afv, 3.7 Å

PDB Description: hiv-1 capsid protein (p24) complex with fab25.3

SCOP Domain Sequences for d1afva_:

Sequence; same for both SEQRES and ATOM records:

>d1afva_ a.73.1.1 (A:) HIV-1 capsid protein {Human immunodeficiency virus type 1}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysptsil

Timeline for d1afva_:

• d1afva_ first appeared (with stable ids) in SCOP 1.55
  
• d1afva_ appears in SCOP 1.61
  
• d1afva_ appears in SCOP 1.65
  
• d1afva_ appears in the current release, SCOPe 2.08