Lineage for d1ak4d_ (1ak4 D:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4827Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
  4. 4828Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) (S)
  5. 4829Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (4 proteins)
  6. 4835Protein HIV-1 capsid protein [47945] (1 species)
  7. 4836Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (6 PDB entries)
  8. 4838Domain d1ak4d_: 1ak4 D: [18322]
    Other proteins in same PDB: d1ak4a_, d1ak4b_

Details for d1ak4d_

PDB Entry: 1ak4 (more details), 2.36 Å

PDB Description: human cyclophilin a bound to the amino-terminal domain of hiv-1 capsid

SCOP Domain Sequences for d1ak4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ak4d_ a.73.1.1 (D:) HIV-1 capsid protein {Human immunodeficiency virus type 1}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmy

SCOP Domain Coordinates for d1ak4d_:

Click to download the PDB-style file with coordinates for d1ak4d_.
(The format of our PDB-style files is described here.)

Timeline for d1ak4d_: