Lineage for d3oofa1 (3oof A:248-476)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012913Protein automated matches [190059] (14 species)
    not a true protein
  7. 2012935Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2013144Domain d3oofa1: 3oof A:248-476 [183203]
    Other proteins in same PDB: d3oofa2, d3oofc2
    automated match to d1osha_
    protein/DNA complex; complexed with oof

Details for d3oofa1

PDB Entry: 3oof (more details), 2.29 Å

PDB Description: crystal structure of human fxr in complex with 4-({(2s)-2-[2-(4- chlorophenyl)-5,6-difluoro-1h-benzimidazol-1-yl]-2- cyclohexylacetyl}amino)benzoic acid
PDB Compounds: (A:) Bile acid receptor

SCOPe Domain Sequences for d3oofa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oofa1 a.123.1.1 (A:248-476) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltpdqqtllhfimdsynkqrmpqeitnkilkeafsaeenfliltematnhvqvlveftk
klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdllearirnsgisdeyit
pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
penpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq

SCOPe Domain Coordinates for d3oofa1:

Click to download the PDB-style file with coordinates for d3oofa1.
(The format of our PDB-style files is described here.)

Timeline for d3oofa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3oofa2