Lineage for d1dvka_ (1dvk A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 643982Fold a.72: Functional domain of the splicing factor Prp18 [47937] (1 superfamily)
    core: 5 helices; bundle
  4. 643983Superfamily a.72.1: Functional domain of the splicing factor Prp18 [47938] (1 family) (S)
  5. 643984Family a.72.1.1: Functional domain of the splicing factor Prp18 [47939] (1 protein)
  6. 643985Protein Functional domain of the splicing factor Prp18 [47940] (1 species)
  7. 643986Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47941] (1 PDB entry)
  8. 643987Domain d1dvka_: 1dvk A: [18319]

Details for d1dvka_

PDB Entry: 1dvk (more details), 2.15 Å

PDB Description: crystal structure of the functional domain of the splicing factor prp18
PDB Compounds: (A:) prp18

SCOP Domain Sequences for d1dvka_:

Sequence, based on SEQRES records: (download)

>d1dvka_ a.72.1.1 (A:) Functional domain of the splicing factor Prp18 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mriqeaiaqdktisviidpsqigstegkpllsmkcnlyiheilsrwkasleayhpelfld
tkkalfplllqlrrnqlapdllislatvlyhlqqpkeinlavqsymklsignvawpigvt
svgiharsahskiqggrnaanimidertrlwitsikrlitfeewytsnh

Sequence, based on observed residues (ATOM records): (download)

>d1dvka_ a.72.1.1 (A:) Functional domain of the splicing factor Prp18 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mriqeaiaqdktisviidpsqigstegkpllsmkcnlyiheilsrwkasleayhpelfld
tkkalfplllqlrrnqlapdllislatvlyhlqqpkeinlavqsymklsignvawpigva
nimidertrlwitsikrlitfeewytsnh

SCOP Domain Coordinates for d1dvka_:

Click to download the PDB-style file with coordinates for d1dvka_.
(The format of our PDB-style files is described here.)

Timeline for d1dvka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dvkb_