SCOPe 2.08: Domain d3omyb_: 3omy B:

Lineage for d3omyb_ (3omy B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.0: automated matches [191573] (1 protein)
   not a true family

6. Protein automated matches [191007] (11 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [189967] (1 PDB entry)

8. Domain d3omyb_: 3omy B: [183187]
   automated match to d1dp3a_
   complexed with gol, mg

Details for d3omyb_

PDB Entry: 3omy, 1.3 Å

PDB Description: Crystal structure of the pED208 TraM N-terminal domain

PDB Compounds: (B:) Protein traM

SCOPe Domain Sequences for d3omyb_:

Sequence; same for both SEQRES and ATOM records:

>d3omyb_ a.55.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
pkiqtyvnnnvyeqitdlvtirkqegieeaslsnvssmllelglrvymiq

Timeline for d3omyb_:

• d3omyb_ first appeared in SCOPe 2.01
  
• d3omyb_ appears in SCOPe 2.07