Lineage for d3omsa_ (3oms A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1200465Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1200466Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1200824Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 1200825Protein automated matches [190239] (6 species)
    not a true protein
  7. 1200826Species Bacillus cereus [TaxId:226900] [189456] (1 PDB entry)
  8. 1200827Domain d3omsa_: 3oms A: [183185]
    automated match to d1u7ia_
    complexed with edo

Details for d3omsa_

PDB Entry: 3oms (more details), 1.9 Å

PDB Description: putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus.
PDB Compounds: (A:) PhnB protein

SCOPe Domain Sequences for d3omsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3omsa_ d.32.1.0 (A:) automated matches {Bacillus cereus [TaxId: 226900]}
qkittflmfegkaeeamnfytslfdqseivsisrydengpgkegtvihatftlngqefmc
idsyvnhnftftpamslyvtceteeeidtvfhklaqdgailmplgsypfskkfgwlndky
gvswqltla

SCOPe Domain Coordinates for d3omsa_:

Click to download the PDB-style file with coordinates for d3omsa_.
(The format of our PDB-style files is described here.)

Timeline for d3omsa_: