Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (6 species) not a true protein |
Species Bacillus cereus [TaxId:226900] [189456] (1 PDB entry) |
Domain d3omsa_: 3oms A: [183185] automated match to d1u7ia_ complexed with edo |
PDB Entry: 3oms (more details), 1.9 Å
SCOPe Domain Sequences for d3omsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3omsa_ d.32.1.0 (A:) automated matches {Bacillus cereus [TaxId: 226900]} qkittflmfegkaeeamnfytslfdqseivsisrydengpgkegtvihatftlngqefmc idsyvnhnftftpamslyvtceteeeidtvfhklaqdgailmplgsypfskkfgwlndky gvswqltla
Timeline for d3omsa_: