SCOPe 2.04: Domain d3omnc_: 3omn C:

Lineage for d3omnc_ (3omn C:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
   12 transmembrane helices in an approximate threefold rotational symmetric arrangement

4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family)

5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
   the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3

6. Protein automated matches [190134] (3 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:272943] [189626] (4 PDB entries)

8. Domain d3omnc_: 3omn C: [183178]
   Other proteins in same PDB: d3omnb1, d3omnb2, d3omnd1, d3omnd2
   automated match to d1m56a_
   complexed with ca, cd, cl, cu1, dmu, hea, hth, mg, oh, trd; mutant

Details for d3omnc_

PDB Entry: 3omn, 2.15 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with d132a mutation in the reduced state

PDB Compounds: (C:) Cytochrome c oxidase, aa3 type, subunit I

SCOPe Domain Sequences for d3omnc_:

Sequence; same for both SEQRES and ATOM records:

>d3omnc_ f.24.1.1 (C:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
wfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgffqs
lwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapamafprmn
nlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhlsga
ssilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltdrnf
gttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpmvya
mvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsielkt
pmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagiyfw
igkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfvssl
gaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppeht

Timeline for d3omnc_:

• d3omnc_ first appeared in SCOPe 2.01
  
• d3omnc_ appears in SCOPe 2.03
  
• d3omnc_ appears in SCOPe 2.05
  
• d3omnc_ appears in the current release, SCOPe 2.08