Lineage for d3omna_ (3omn A:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1958596Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 1958597Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 1958598Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 1958668Protein automated matches [190134] (3 species)
    not a true protein
  7. 1958708Species Rhodobacter sphaeroides [TaxId:272943] [189626] (4 PDB entries)
  8. 1958709Domain d3omna_: 3omn A: [183177]
    Other proteins in same PDB: d3omnb1, d3omnb2, d3omnd1, d3omnd2
    automated match to d1m56a_
    complexed with ca, cd, cl, cu1, dmu, hea, hth, mg, oh, trd; mutant

Details for d3omna_

PDB Entry: 3omn (more details), 2.15 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with d132a mutation in the reduced state
PDB Compounds: (A:) Cytochrome c oxidase, aa3 type, subunit I

SCOPe Domain Sequences for d3omna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3omna_ f.24.1.1 (A:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
ftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgf
fqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapamafp
rmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhl
sgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltd
rnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpm
vyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsie
lktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagi
yfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfv
sslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtf

SCOPe Domain Coordinates for d3omna_:

Click to download the PDB-style file with coordinates for d3omna_.
(The format of our PDB-style files is described here.)

Timeline for d3omna_: