Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) |
Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
Protein automated matches [190134] (3 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:272943] [189626] (4 PDB entries) |
Domain d3omic_: 3omi C: [183172] automated match to d1m56a_ complexed with ca, cd, cl, cu, cu1, dmu, fe, hea, hth, mg, oh, trd; mutant |
PDB Entry: 3omi (more details), 2.15 Å
SCOPe Domain Sequences for d3omic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3omic_ f.24.1.1 (C:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]} wfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgffqs lwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapamafprmn nlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhlsga ssilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltdrnf gttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpmvya mvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsielkt pmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagiyfw igkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfvssl gaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppeh
Timeline for d3omic_: