SCOPe 2.04: Domain d3omia_: 3omi A:

Lineage for d3omia_ (3omi A:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
   12 transmembrane helices in an approximate threefold rotational symmetric arrangement

4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family)

5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
   the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3

6. Protein automated matches [190134] (3 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:272943] [189626] (4 PDB entries)

8. Domain d3omia_: 3omi A: [183171]
   Other proteins in same PDB: d3omib1, d3omib2, d3omid1, d3omid2
   automated match to d1m56a_
   complexed with ca, cd, cl, cu, cu1, dmu, fe, hea, hth, mg, oh, trd; mutant

Details for d3omia_

PDB Entry: 3omi, 2.15 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with d132a mutation

PDB Compounds: (A:) Cytochrome c oxidase, aa3 type, subunit I

SCOPe Domain Sequences for d3omia_:

Sequence; same for both SEQRES and ATOM records:

>d3omia_ f.24.1.1 (A:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
ftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgf
fqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapamafp
rmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhl
sgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltd
rnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpm
vyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsie
lktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagi
yfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfv
sslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtf

Timeline for d3omia_:

• d3omia_ first appeared in SCOPe 2.01
  
• d3omia_ appears in SCOPe 2.03
  
• d3omia_ appears in SCOPe 2.05
  
• d3omia_ appears in the current release, SCOPe 2.08