Lineage for d3om8a1 (3om8 A:2-264)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902837Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189478] (7 PDB entries)
  8. 2902843Domain d3om8a1: 3om8 A:2-264 [183166]
    Other proteins in same PDB: d3om8a2, d3om8b2
    automated match to d1va4a_
    complexed with edo, mes

Details for d3om8a1

PDB Entry: 3om8 (more details), 2.25 Å

PDB Description: The crystal structure of a hydrolase from Pseudomonas aeruginosa PA01
PDB Compounds: (A:) Probable hydrolase

SCOPe Domain Sequences for d3om8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3om8a1 c.69.1.0 (A:2-264) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
gnlsflatsdgaslayrldgaaekpllalsnsigttlhmwdaqlpaltrhfrvlrydarg
hgassvppgpytlarlgedvlelldalevrrahflglslggivgqwlalhapqrierlvl
antsawlgpaaqwderiaavlqaedmsetaagflgnwfppalleraepvverframlmat
nrhglagsfaavrdtdlraqlarierptlviagaydtvtaashgeliaasiagarlvtlp
avhlsnvefpqafegavlsflga

SCOPe Domain Coordinates for d3om8a1:

Click to download the PDB-style file with coordinates for d3om8a1.
(The format of our PDB-style files is described here.)

Timeline for d3om8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3om8a2