Lineage for d3om3a_ (3om3 A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632295Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 2632296Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 2632297Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 2632417Protein automated matches [190134] (4 species)
    not a true protein
  7. 2632460Species Rhodobacter sphaeroides [TaxId:272943] [189626] (6 PDB entries)
  8. 2632471Domain d3om3a_: 3om3 A: [183148]
    Other proteins in same PDB: d3om3b1, d3om3b2, d3om3b3, d3om3d1, d3om3d2, d3om3d3
    automated match to d1m56a_
    complexed with ca, cd, cu1, dmu, hea, hth, mg, trd; mutant

Details for d3om3a_

PDB Entry: 3om3 (more details), 2.6 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with k362m mutation in the reduced state
PDB Compounds: (A:) Cytochrome c oxidase, aa3 type, subunit I

SCOPe Domain Sequences for d3om3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3om3a_ f.24.1.1 (A:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
ftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgf
fqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafp
rmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhl
sgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltd
rnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpm
vyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgimifswiatmwggsie
lktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagi
yfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfv
sslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtf

SCOPe Domain Coordinates for d3om3a_:

Click to download the PDB-style file with coordinates for d3om3a_.
(The format of our PDB-style files is described here.)

Timeline for d3om3a_: