SCOPe 2.02: Domain d3om3a_: 3om3 A:

Lineage for d3om3a_ (3om3 A:)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
   12 transmembrane helices in an approximate threefold rotational symmetric arrangement

4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family)

5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
   the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3

6. Protein automated matches [190134] (4 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:272943] [189626] (4 PDB entries)

8. Domain d3om3a_: 3om3 A: [183148]
   automated match to d1m56a_
   complexed with ca, cd, cu1, dmu, hea, hth, mg, trd; mutant

Details for d3om3a_

PDB Entry: 3om3, 2.6 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with k362m mutation in the reduced state

PDB Compounds: (A:) Cytochrome c oxidase, aa3 type, subunit I

SCOPe Domain Sequences for d3om3a_:

Sequence; same for both SEQRES and ATOM records:

>d3om3a_ f.24.1.1 (A:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
ftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgf
fqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafp
rmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhl
sgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltd
rnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpm
vyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgimifswiatmwggsie
lktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagi
yfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfv
sslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtf

Timeline for d3om3a_:

• d3om3a_ first appeared in SCOPe 2.01
  
• d3om3a_ appears in SCOPe 2.03
  
• d3om3a_ appears in the current release, SCOPe 2.08