SCOPe 2.03: Domain d3olna_: 3oln A:

Lineage for d3olna_ (3oln A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.12: SRA domain-like [159368] (2 proteins)
   Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA

6. Protein automated matches [191193] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189495] (1 PDB entry)

8. Domain d3olna_: 3oln A: [183143]
   automated match to d2zkda1

Details for d3olna_

PDB Entry: 3oln, 2.3 Å

PDB Description: Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF2

PDB Compounds: (A:) E3 ubiquitin-protein ligase UHRF2

SCOPe Domain Sequences for d3olna_:

Sequence, based on SEQRES records:

>d3olna_ b.122.1.12 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivpsnhygpipgipvgstwrfrvqvseagvhrphvggihgrsndgayslvlaggfadevd
rgdeftytgsggknlagnkrigapsadqtltnmnralalncdaplddkigaesrnwragk
pvrvirsfkgrkiskyapeegnrydgiykvvkywpeissshgflvwryllrrddvepapw
tsegiersrrlc

Sequence, based on observed residues (ATOM records):

>d3olna_ b.122.1.12 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivpsnhygpipgipvgstwrfrvqvseagvhrphvggihgrsndgayslvlaggfadevd
rgdeftytgsggpsadqtltnmnralalncdaplddkigaesrnwragkpvrvirsfkgr
kiskyapeegnrydgiykvvkywpeissshgflvwryllrrddvepapwtsegiersrrl
c

Timeline for d3olna_:

• d3olna_ first appeared in SCOPe 2.01
  
• d3olna_ appears in SCOPe 2.02
  
• d3olna_ appears in SCOPe 2.04
  
• d3olna_ appears in the current release, SCOPe 2.08